DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and c1galt1b

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_956345.1 Gene:c1galt1b / 337131 ZFINID:ZDB-GENE-030131-9075 Length:374 Species:Danio rerio


Alignment Length:291 Identity:96/291 - (32%)
Similarity:148/291 - (50%) Gaps:31/291 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SHTNRTGASTSLDIDLTDEVRVLCYVYTKPINHKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGS 118
            :|.:.||...:|...|...||:||:|.|.|.|.:.:|:.|..||.|.||.::|.||..:.:.. :
Zfish    68 NHPHHTGEDGALADSLYKRVRILCWVMTGPDNLEKKARHVKATWSRHCNIVVFISSVDNPDFP-T 131

  Fly   119 VELPVSPYFRESWLKTKMALKYLHDHHLNDADWFLEADDETYVVMENLRYMVYPYSPQLAIYF-- 181
            |.|.......:.:.||..|..|:.:.|.::|||||:|||:|||:::|||:::..:||:..:||  
Zfish   132 VGLNTKEGRDQLYWKTIRAFHYVMEKHSDEADWFLKADDDTYVIVDNLRWILARHSPEDPVYFGR 196

  Fly   182 ------------GSPGTVMSRAALRRLVE----LSLPNPSKCEQKNAGPTAEKLRECLENVNVLA 230
                        |..|.|:|:.||||.||    ....:.:..|....|       :|:|.:.|.|
Zfish   197 RFKPYVKQGYMSGGAGYVLSKEALRRFVEGFRTKVCTHTTSVEDLAMG-------QCMEKIGVKA 254

  Fly   231 GNTYDSEGRRRMYLIEPQARSNLFLHYDSNIWFWKFLAYRTQDGIFAWSNYAVSFHYVQHRYIHC 295
            |::.|:..|...:...|:  |:|...:....|:|.:..|....|....|:.|||||||...:::.
Zfish   255 GDSRDTMQRETFHPFVPE--SHLTGTFPKTFWYWNYCYYPIVQGPQCCSDLAVSFHYVDASHMYL 317

  Fly   296 FEYMIYRLRTFGRKQIVESLPPKYN-PAAEK 325
            .||..|.||.||.|...:  ||:.| .|.||
Zfish   318 LEYYTYHLRAFGYKYRYQ--PPEPNVKAPEK 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 36/111 (32%)
c1galt1bNP_956345.1 Galactosyl_T 107..274 CDD:304462 54/176 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..374
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.