DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and CG18558

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_608720.2 Gene:CG18558 / 33482 FlyBaseID:FBgn0031469 Length:588 Species:Drosophila melanogaster


Alignment Length:297 Identity:92/297 - (30%)
Similarity:150/297 - (50%) Gaps:38/297 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PIMDLKSHTNRTG-ASTSLDIDLTD----EVRVLCYVYTKPINHKTQAQAVLETWGRRCNKLIFF 107
            |:.:|:|....|. ||..|:..|..    .||::|.|.|.|..:.:.|:|:.|||||.||::|::
  Fly   290 PLPELRSPNPLTKIASRPLNDQLAKMMYRSVRIICLVLTWPKKYMSGARAISETWGRHCNRVIYY 354

  Fly   108 SSRSDLNLTG--SVELPVSPYFRESWLKTKMALKYLHDHHLNDADWFLEADDETYVVMENLRYMV 170
            .|.....::|  .|.|..|....:.|.|||.|.::.:.::.::.|||.:|||:||.||||:|.::
  Fly   355 GSFPGTTISGLEIVGLNASDTRSKLWGKTKAAFRHAYRNYGHEVDWFYKADDDTYAVMENMRKLL 419

  Fly   171 YPYSPQLAIYFGSP-------------GTVMSRAALRRLVELSLPNPSKCEQKNAGPTAEKLREC 222
            .||||...||||||             |.|:|::|:..   |:|.....|:..:.|.....:.:|
  Fly   420 KPYSPSNPIYFGSPFKLGSTLYMSGGAGYVLSKSAVEL---LNLGAAENCQPGDQGTEDYVMGKC 481

  Fly   223 LENVNVLAGNTYDSEGRRRMYLIEPQARSNLFLHY------DSNIWFWKFLAYRTQDGIFAWSNY 281
            |..:.|.||::.|..||:|.:.:..:       |:      |...|..::|...|..|:...|.|
  Fly   482 LSLLQVQAGDSRDLLGRQRFFSLSLE-------HFLIPNRDDEGFWLQEYLYQTTGTGLECCSTY 539

  Fly   282 AVSFHYVQHRYIHCFEYMIYRLRTFGRKQIVESLPPK 318
            ::|.|.|....:|..|.::|:.|.:|  .:....||:
  Fly   540 SISIHNVSPYEMHFLETILYKRRPYG--LLAGHAPPR 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 41/99 (41%)
CG18558NP_608720.2 Galactosyl_T <400..>458 CDD:304462 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449727
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.