DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and CG2975

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster


Alignment Length:339 Identity:114/339 - (33%)
Similarity:167/339 - (49%) Gaps:61/339 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VLFLLLGIGIGYLITKVLV---WPIMDLKSHTNRTGASTS------------------------- 64
            :|.||:|:..|.|:::::.   |     ::|.:|....:|                         
  Fly    13 MLMLLIGLAWGILLSELMKRTRW-----QNHADRLKEESSPFPSSQRSRNLRTPPTIAPSTTNPP 72

  Fly    65 ---LDIDLTDEVRVLCYVYTKPINHKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGSVELPVSPY 126
               |...|.:|.||||.|.|.|..|.|:|..:..|||||||||||.|:::|..| |||.|.|...
  Fly    73 PDILAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKEL-GSVALNVREG 136

  Fly   127 FRESWLKTKMALKYLHDHHLNDADWFLEADDETYVVMENLRYMVYPYSPQLAIYFGS-------- 183
            :...|.||:.||:|::.||....||||:|||:||.:|||||..::.::.:..:|||:        
  Fly   137 YSNLWPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKE 201

  Fly   184 ------PGTVMSRAALRRLVELSLPNPSKCEQKNAGPTAEKLRECLENVNVLAGNTYDSEGRRRM 242
                  .|.|:|:.||.||::|...|.|.|..:|.|....:|..||..|.|:.|::.|.:|..|.
  Fly   202 GYMSGGAGYVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRF 266

  Fly   243 YLIEPQARSNLFLHY--DSNIWFWKFLAYRTQDGIF-AWSNYAVSFHYVQHRYIHCFEYMIYRLR 304
            ....|       ||:  ....|:...|.|.:.|... ..||.|:||||...:..:..||:||:||
  Fly   267 IPFSP-------LHWYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKLR 324

  Fly   305 TFGRKQIVESLPPK 318
            .||..:.:..||.|
  Fly   325 IFGINRELGPLPKK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 47/111 (42%)
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 52/124 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458856
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.