DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and CG3119

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster


Alignment Length:319 Identity:100/319 - (31%)
Similarity:159/319 - (49%) Gaps:27/319 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TSPSTARPVLFLLLGIGIGYLITKVLVWPIMDLK------SHTNRTGASTSLDIDLTDEVRVLCY 78
            |:....|..|.||.|...|:::..||:..:.|:.      |.|:....:|:..|:.....|:||.
  Fly     2 TAKMKLRSQLHLLTGFMAGFVLAFVLLLYVYDVSRVTPCWSSTSTMTTATTARIEDGPPPRILCM 66

  Fly    79 VYTKPINHKTQAQAVLETWGRRCNKLIFFSSR--SDLNLTGSVELPVSPYFRESWLKTKMALKYL 141
            |.|.|.|.::.|::|.||||:||::|||.||.  ..|.:.|.|| |....:.:.|.||:...:::
  Fly    67 VLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVE-PTGGGYEDLWNKTREGFRHV 130

  Fly   142 HDHHLNDADWFLEADDETYVVMENLRYMVYPYSPQLAIYFG-----------SPGT--VMSRAAL 193
            .:|:..|.||||:|||:||||||||::::..:.|...::||           |.|.  ::||.||
  Fly   131 WEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSRYNVSYMSGGASYILSREAL 195

  Fly   194 RRLVELSLPNPSKCEQ-KNAGPTAEKLRECLENVNV-LAGNTYDSEGRRRMYLIEPQARSNLF-- 254
            .|....:..:...|.| |..|.....:..|::||.| ...:|:..:|..:...: |....|..  
  Fly   196 HRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFM-PLDLENYMSD 259

  Fly   255 LHYDSNIWFWKFLAYRTQDGIFAWSNYAVSFHYVQHRYIHCFEYMIYRLRTFGRKQIVE 313
            .:|....|.......|.:.|:...|||:|:|||.....:..:|::||.|:.|...||.|
  Fly   260 ANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVFDPNQISE 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 41/110 (37%)
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 51/149 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458864
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.