DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and tgy

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001285425.1 Gene:tgy / 32896 FlyBaseID:FBgn0030984 Length:373 Species:Drosophila melanogaster


Alignment Length:364 Identity:122/364 - (33%)
Similarity:181/364 - (49%) Gaps:60/364 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ECVFLDRSN-----HSQPNTTSP---------STARPVLFLLLGIGIGYLITKVL----VWPIMD 51
            |.:.|:.|:     ||..|..:.         ||.|.||.:||      :.|.|:    .|.:|.
  Fly     4 EYIILENSSTYPGFHSSSNGLANGMYRSAQRISTDRLVLLILL------VSTTVIGLFAYWDVMV 62

  Fly    52 LKSHTNRTGASTSLDIDLTD--------------EVRVLCYVYTKPINHKTQAQAVLETWGRRCN 102
            |.:........|| .:|..:              ||||||:|.|.|..|||:|..||.|||:|||
  Fly    63 LNAGALPLSRGTS-SVDYMEPGLRNETLAEKMHREVRVLCWVLTTPKYHKTRAIHVLRTWGKRCN 126

  Fly   103 KLIFFSSRSDLNLTGSVELPVSPYFRESWLKTKMALKYLHDHHLNDADWFLEADDETYVVMENLR 167
            |:.|.:|..|..|. :|.|.....:...|.|||.|..::|:...::||||::|||:||:.:||||
  Fly   127 KIYFMTSEPDDELP-TVVLTKPDRYEMLWGKTKEAFVHIHEQMRHEADWFIKADDDTYLFLENLR 190

  Fly   168 YMVYPYSPQLAIYF------------------GSPGTVMSRAALRRLVELSLPNPSKCEQKNAGP 214
            ||:|||||:..|||                  |..|.|:||.|||...| .:.:.:||.|::...
  Fly   191 YMLYPYSPETPIYFGFNYKMVGTHQKNESYMSGGSGYVLSREALRIFAE-GVNDTTKCRQEDDHA 254

  Fly   215 TAEKLRECLENVNVLAGNTYDSEGRRRMYLIEPQARSNLFLHYDSNIWFWKFLAYRTQDGIFAWS 279
            ...::.:||.|:.|.||::.|.:.|.|.|.|.|.. :.|..:...:.|.:|:..|..:..:...|
  Fly   255 EDVEMGKCLFNLGVKAGDSRDEQLRNRFYPIAPYG-ALLSGNVGMDFWLYKYAYYNPRSCMDCLS 318

  Fly   280 NYAVSFHYVQHRYIHCFEYMIYRLRTFGRKQIVESLPPK 318
            .|.|:||||..:.::.::|..|:.:..||.|:.|.||.|
  Fly   319 EYPVAFHYVHSKQLYVYDYFNYQFQLSGRAQVAERLPKK 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 49/115 (43%)
tgyNP_001285425.1 Galactosyl_T 103..>270 CDD:304462 67/168 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449725
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.