DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and c1galt1c1

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_955961.2 Gene:c1galt1c1 / 324052 ZFINID:ZDB-GENE-030131-2772 Length:317 Species:Danio rerio


Alignment Length:269 Identity:70/269 - (26%)
Similarity:123/269 - (45%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 EVRVLCYVYTKP--INHKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGSVELPVSPYFRESWLKT 134
            :|||.|.:...|  :.|...|.   :||.:.|:|.:|::|.:...| .:|:|..    ::.|.:.
Zfish    66 QVRVYCLIMVTPKLLVHWATAN---DTWSKHCDKSVFYTSEASKAL-DAVDLQE----QDEWTRL 122

  Fly   135 KMALKYLHDHHLNDADWFLEADDETYVVMENLRYMVYPYSPQLAIYFG-------------SPGT 186
            :.|:::.:: :..|..||..|...|:.::|||:|:|....|....|.|             ..|.
Zfish   123 RKAIQHAYE-NAGDLHWFFIARPTTFAIIENLKYLVLDKDPSQPFYIGHTEKSGELDYVEYDSGI 186

  Fly   187 VMSRAALRRLVELSLPNPSKCEQKNAG----PTAEKLRECLENVNVLAGNTYDSEGRRRMYLIEP 247
            |:|..|:|||:|: ..:..||.::...    ...::|..||:...|.|.|..|::|:.   |...
Zfish   187 VLSYEAMRRLMEV-FKDEDKCPERGRALWKMSEEKQLATCLKYSGVFAENGEDAQGKG---LFNK 247

  Fly   248 QARSNLFLHYDSNIWFWKFLAYRTQDGIFA-WSNYAVSFHYVQHRYIHCFEYMIYRLRTFGR--K 309
            ::.|:|.  .||       ::....|.:.| .|:.|::|..:....|....|.:||||.:|.  .
Zfish   248 KSVSSLI--SDS-------ISQNPGDVVEACCSDMAITFAGMSPSQIQVLMYGVYRLRPYGHDFH 303

  Fly   310 QIVESLPPK 318
            ..:..||||
Zfish   304 DSLTFLPPK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 26/110 (24%)
c1galt1c1NP_955961.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589112
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.