DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and C1galt1c1

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001025204.1 Gene:C1galt1c1 / 302499 RGDID:1311230 Length:316 Species:Rattus norvegicus


Alignment Length:310 Identity:83/310 - (26%)
Similarity:131/310 - (42%) Gaps:73/310 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SHTNRTGASTSLDIDLTDEVRVLCYVYTKPINHKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGS 118
            |.|.|        ::|:...:|.|.|..||.:....| ||.|||.:.|:|..|||| .::.:..|
  Rat    54 SETER--------MELSKSFQVYCIVLVKPKDVSLWA-AVKETWTKHCDKAEFFSS-ENVKVFES 108

  Fly   119 VELPVSPYFRESWLKTKMALKYLHDHHLNDADWFLEADDETYVVMENLRYMVYPYSPQLAIYFG- 182
            :.:..:    :.||..:.|.||.:|.:.:..:||..|...|:.|:|||:|.:....|....|.| 
  Rat   109 INMDTN----DMWLMMRKAYKYAYDKYKDQYNWFFLARPTTFAVIENLKYFLLRKDPSQPFYLGH 169

  Fly   183 ------------SPGTVMSRAALRRLVELSLPNPSKCEQKNAGPTAEKLRE------CLENVNVL 229
                        ..|.|:|..:::||..| |..|.||.::  |....|:.|      ||:...|.
  Rat   170 TVKSGDLEYVSVDGGIVLSIESMKRLNGL-LSVPEKCPEQ--GGMIWKISEDKQLAVCLKYAGVF 231

  Fly   230 AGNTYDSEGR-----RRMYLIEPQARSNLFLHYDSNIWFWKFLAYRTQDGIFAWSNYAVSFHYVQ 289
            |.|..|::|:     :.:.|...:|.:|     ..|         :..:|  ..|:.||:|:.:.
  Rat   232 AENAEDADGKDVFNTKSVGLFIKEAMTN-----QPN---------QVVEG--CCSDMAVTFNGLT 280

  Fly   290 HRYIHCFEYMIYRLRTFGR--KQIVESLPPKYNPAAEKDQGAPRIGSDQD 337
            ...:|...|.:||||.||.  ...:..|||.              ||:.|
  Rat   281 PNQMHVMMYGVYRLRAFGHVFNDALVFLPPN--------------GSEND 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 31/110 (28%)
C1galt1c1NP_001025204.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.