DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and C1GALT1C1

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001011551.1 Gene:C1GALT1C1 / 29071 HGNCID:24338 Length:318 Species:Homo sapiens


Alignment Length:293 Identity:77/293 - (26%)
Similarity:124/293 - (42%) Gaps:57/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IDLTDEVRVLCYVYTKPINHKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGSVELPVSPYFRESW 131
            ::|:...||.|.:..||.:....| ||.|||.:.|:|..|||| .::.:..|:.:..:    :.|
Human    61 MELSKSFRVYCIILVKPKDVSLWA-AVKETWTKHCDKAEFFSS-ENVKVFESINMDTN----DMW 119

  Fly   132 LKTKMALKYLHDHHLNDADWFLEADDETYVVMENLRYMVYPYSPQLAIYFG-------------S 183
            |..:.|.||..|.:.:..:||..|...|:.::|||:|.:....|....|.|             .
Human   120 LMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGME 184

  Fly   184 PGTVMSRAALRRLVELSLPNPSKCEQKNAGPTAEKLRE------CLENVNVLAGNTYDSEGRRRM 242
            .|.|:|..:::||..| |..|.||.::  |....|:.|      ||:...|.|.|..|::|:   
Human   185 GGIVLSVESMKRLNSL-LNIPEKCPEQ--GGMIWKISEDKQLAVCLKYAGVFAENAEDADGK--- 243

  Fly   243 YLIEPQARSNLFLHYDSNIWFWKFLAYRTQDGI-FAWSNYAVSFHYVQHRYIHCFEYMIYRLRTF 306
                     ::|......:...:.:.|.....: ...|:.||:|:.:....:|...|.:||||.|
Human   244 ---------DVFNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAF 299

  Fly   307 GR--KQIVESLPPKYNPAAEKDQGAPRIGSDQD 337
            |.  ...:..|||.              |||.|
Human   300 GHIFNDALVFLPPN--------------GSDND 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 30/110 (27%)
C1GALT1C1NP_001011551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.