DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and F56H6.1

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_493101.1 Gene:F56H6.1 / 186412 WormBaseID:WBGene00010162 Length:327 Species:Caenorhabditis elegans


Alignment Length:294 Identity:66/294 - (22%)
Similarity:118/294 - (40%) Gaps:73/294 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ASTSLDIDLTDEVRVLCYVYTKPINHKTQAQAVLETWGRRCNKLIFFSSR--SDLNLT-GSVELP 122
            ::::|::..|.:  :.|:|.|..:::..:..::..||..:|:...||:..  .:.|:| .:|.|.
 Worm    68 SASALELPSTGQ--LFCFVETSAVHYDDRVPSIASTWLPKCDNGRFFTKTPLPNSNMTYSTVYLN 130

  Fly   123 VSPYFRESWLKTKMALKYLHDHHLNDADWFLEADDETYVVMENLR------------YMVYPYSP 175
            :...:.:.:.||.....|.:.|.....||:|:|||:||..|::|:            |:.|...|
 Worm   131 LKDSYYDLFRKTTFGFYYSYMHISKSFDWYLKADDDTYFAMDHLKEYLSTLDPTKPLYLGYVLKP 195

  Fly   176 QLAIYF------GSPGTVMSRAALRRLVELSLPNPSKC-----EQKNAGPTAEKLRECLENVNVL 229
                ||      |..|.::|.||::..||....:...|     |.:..|       .|:....:.
 Worm   196 ----YFKNGYNSGGSGYILSNAAVKLFVEKLYHDEYTCPYDWAEDRGMG-------RCMARAGIF 249

  Fly   230 AGNTYDSEGRRRMYLIEPQARSNL--FLHYDSNIWFWKFLAYRTQDGIFAWSNYAVSFHYVQHRY 292
            ..:|.|.:|..|....:|...:.:  ..||           |..:.|.:| |...||.|.:..  
 Worm   250 PTDTRDDKGLNRFMPFKPSELAGVGPEWHY-----------YPMEAGQYA-SQKFVSLHRLPQ-- 300

  Fly   293 IHCFEYMIYRLRTFGRKQIVESLPPK-----YNP 321
                :.||         .:.:.|.||     |||
 Worm   301 ----DMMI---------SLDDILHPKLGKRVYNP 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 29/118 (25%)
F56H6.1NP_493101.1 Galactosyl_T <127..254 CDD:304462 32/137 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163279
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D555141at33208
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.