DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and F37A4.3

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_498472.2 Gene:F37A4.3 / 185403 WormBaseID:WBGene00018133 Length:272 Species:Caenorhabditis elegans


Alignment Length:131 Identity:32/131 - (24%)
Similarity:49/131 - (37%) Gaps:21/131 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 ESWLKTKMALKYLHDHHL-NDADWFLEADDETYVVMENLRYMVYPYSPQLAIYF----------G 182
            |.||....:...||...| ..|.|::.|.|..|..:|.|...:..:...|.||.          .
 Worm    86 EQWLIHHFSKMILHTRRLPQQAQWYMFAFDNNYFFVERLIKELSKFDSHLPIYTILRDFHADIQH 150

  Fly   183 SPGTVMSRAALRRLVELSLPNPSKCEQKNAGPTAEKLRECLENVNVLAGNT--YDSEGRRRMYLI 245
            .|..:.||:||....:|        |::|....||.:.|.|.....:...|  .|...:.|::.|
 Worm   151 KPVLIFSRSALNTFYDL--------EEENCSENAENVEEWLTTCMSIPPITISVDRSKKSRIFAI 207

  Fly   246 E 246
            :
 Worm   208 K 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 16/65 (25%)
F37A4.3NP_498472.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.