DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and C17A2.3

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_494669.1 Gene:C17A2.3 / 182699 WormBaseID:WBGene00015871 Length:348 Species:Caenorhabditis elegans


Alignment Length:205 Identity:50/205 - (24%)
Similarity:81/205 - (39%) Gaps:47/205 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RVLCYVYTKPINHKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGSVELP-----VSPYFR----- 128
            ::.|:|.|....:|.:..:|..||..||:...||:         ...||     .|..:|     
 Worm   101 QIFCFVETSTKYYKDRVPSVASTWLPRCDHGRFFT---------KTHLPYPDIAYSTVYRNLRDT 156

  Fly   129 --ESWLKTKMALKYLHDHHLNDADWFLEADDETYVVMENLRYMVYPYSPQLAIYF---------- 181
              :.:.|:..:|.|.:.......||:|:.||:|:|.|::||..:...:|...:|.          
 Worm   157 YDDLFRKSIFSLYYSYTSISKHFDWYLKTDDDTFVAMDHLREYLNTLNPAEPLYLGYRLAPFMNN 221

  Fly   182 ----GSPGTVMSRAALRRLVELSLPNPSKC-----EQKNAGPTAEKLRECLENVNVLAGNTYDSE 237
                |..|.::|.||:|..||....|...|     |.:..|       .|||:|.:...:|.|.:
 Worm   222 GYNSGGSGYILSNAAMRMFVEQLYHNVRLCPYDRGEDRGMG-------RCLESVGITPSDTRDDQ 279

  Fly   238 GRRRMYLIEP 247
            ...|.....|
 Worm   280 ELNRFMPFRP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 28/123 (23%)
C17A2.3NP_494669.1 Galactosyl_T 98..>239 CDD:304462 35/146 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163263
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.