DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and C02H6.1

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_504891.1 Gene:C02H6.1 / 182129 WormBaseID:WBGene00015361 Length:334 Species:Caenorhabditis elegans


Alignment Length:259 Identity:59/259 - (22%)
Similarity:106/259 - (40%) Gaps:45/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DLTDEVRVLCYVYTKPINHKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGSVE--LPVSPYFR-- 128
            ||....::.|:|.|.......:..::..||..||:...||..      |..|:  :|.|..:|  
 Worm    80 DLPTSGQLFCFVETSKKYFNDRVPSMASTWLPRCDNGRFFLK------TPLVDEKIPFSTVYRNL 138

  Fly   129 -----ESWLKTKMALKYLHDHHLNDADWFLEADDETYVVMENLR------------YMVYPYSPQ 176
                 :.:.||.::..|.:.:...|.||:|:|||:.|.::::|:            ::.|...|.
 Worm   139 EDSYYDLFRKTLLSFYYSYTYISKDFDWYLKADDDNYFMIDHLKEYLDTLDASKPLFLGYRMKPF 203

  Fly   177 L--AIYFGSPGTVMSRAALRRLVELSLPNPSKCEQKNAGPTAEKLRECLENVNVLAGNTYDSEGR 239
            |  ....|..|.::|.||:|..||....:..:|....|....  :..||.::.:|..:|.|::|.
 Worm   204 LEGGYNSGGAGYLLSNAAVRIFVEHLYHDEKRCPYDWAEDRG--IARCLASMGILPSDTRDNDGS 266

  Fly   240 RRMYLIEPQARSNL--FLHYDSNIWFWKFLAYRTQDGIFAWSNYAVSFHYVQHRYIHCFEYMIY 301
            .|.....|.....:  ..||           |..::|.|. |...:|.|.:..|.:...:.::|
 Worm   267 CRFLPFRPSEMPGIPEAYHY-----------YPLKNGSFV-SEKFISLHRISPRKMIFLDSILY 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 27/120 (23%)
C02H6.1NP_504891.1 Galactosyl_T 83..>223 CDD:304462 34/145 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.