DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and W09D10.5

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_499361.3 Gene:W09D10.5 / 176496 WormBaseID:WBGene00012363 Length:321 Species:Caenorhabditis elegans


Alignment Length:322 Identity:69/322 - (21%)
Similarity:123/322 - (38%) Gaps:72/322 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VLFLLLGIGIGYLITKVLVW-------PIMDLKSHTNRTGASTSLDIDLTDEVRVLCYVYTKPIN 85
            |:.|.||:.:||||..:.::       ..:.|..|...|....|.::        .|.:......
 Worm    18 VIHLALGVSLGYLIGILFIFDGDNDISKHIHLMEHEKSTPKPESFNL--------RCVIILHKAT 74

  Fly    86 HKTQ--AQAVLETWGRRCNKLIFFSSRSDL---------NLTGSVELPVSPYFRESWLKTKMALK 139
            ||.:  ..|:.:.:.:.|.:.|||::...|         |.|        .|..:|.|.......
 Worm    75 HKPENIISAITDGYAKLCQETIFFTNNQKLFDKFQKFQNNYT--------MYHVDSSLNHFYWTY 131

  Fly   140 YLHDHHLND---ADWFLEADDETYVVMENLRYMVYPYSPQLAIYFGS------------PGTVMS 189
            ||:....:.   |.|....||:||:::.|||..:..:..:..:..|.            |.:...
 Worm   132 YLYAMEFSSKVPAQWTFLGDDQTYLIVPNLRNTLRNFDSEKPVVLGKVKDTSTLFSWLFPLSSFK 196

  Fly   190 RAALRRLVELSLPNP-----SKCEQ---KNAGPTAEKLRECLENVNVLAGNTYDSEGRRRMYLIE 246
            :.::|..|.||  ||     |.|:.   ..|...|  |.:|.|...|...:.:|.:..|....:.
 Worm   197 KISVRGGVVLS--NPAIDKLSACKGFFFSRASDFA--LYDCSEKYGVQIADPFDEDALRLFNDLP 257

  Fly   247 PQARSNLFLHYDSNIWFWKFLAYRTQDGIFAWSNYAVSFHYVQHRYIHCFEYMIYRLRTFGR 308
            |:.    .:..||.:    |.:..|:.|  ..|::|:||..:..:.:...::.: .|:.|||
 Worm   258 PKQ----IIAPDSKL----FRSSPTKAG--KCSDHAISFGQLSEKDMRVLQFGM-SLKVFGR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 25/123 (20%)
W09D10.5NP_499361.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.