DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and c1galt1

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_002938761.1 Gene:c1galt1 / 100487794 XenbaseID:XB-GENE-992000 Length:362 Species:Xenopus tropicalis


Alignment Length:309 Identity:98/309 - (31%)
Similarity:157/309 - (50%) Gaps:41/309 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DLKSHTNRTGASTSLDIDLTDEVRVLCYVYTKPINHKTQAQAVLETWGRRCNKLIFFSSRSDLNL 115
            |.:.|.:.   .|.:..||..:|::||:|.|.|.|...:.:.|..||.:||||:::.||..:...
 Frog    72 DAQQHHDE---DTHVADDLYSKVKILCWVMTGPQNLDKKTKHVKATWAQRCNKVLYMSSEENKEF 133

  Fly   116 TGSVELPVSPYFRESWLKTKMALKYLHDHHLNDADWFLEADDETYVVMENLRYMVYPYSPQLAIY 180
            . :|.|.......:.:.||..|.:|:|||||.:||||::|||:||||::|||:::..:.|...:|
 Frog   134 P-TVGLDTKEGRDQLYWKTIKAFQYVHDHHLEEADWFMKADDDTYVVLDNLRWLLSKHDPNDPVY 197

  Fly   181 F--------------GSPGTVMSRAALRRLVELSLPNPSKCEQKNAGPTAEKLR--ECLENVNVL 229
            |              |..|.|:|:.||:|.|     |..|.|:.....:.|.|.  :|:||:||.
 Frog   198 FGRRFKPYVKQGYMSGGAGYVLSKEALKRFV-----NAFKEEKCTHSSSVEDLALGKCMENINVK 257

  Fly   230 AGNTYDSEGRRRMYLIEPQARSNLFLH--YDSNIWFWKFLAYRTQDGIFAWSNYAVSFHYVQHRY 292
            ||::.|:.|:...:...|:   :..:|  .....|:|.:..|...:|....|:.|||||||....
 Frog   258 AGDSRDTSGKETFHPFVPE---HHLIHGYLPKTFWYWNYNYYPAVEGPGCCSDLAVSFHYVDSTT 319

  Fly   293 IHCFEYMIYRLRTFGRKQIVESLPPKYNPAAEKDQGAPRIGSDQDVPAD 341
            ::..||:::.||.:|.|.       :|:|    |..|..:..|.|...|
 Frog   320 MYQLEYLVHHLRPYGYKH-------RYSP----DSTAKTMKDDTDKTKD 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 38/111 (34%)
c1galt1XP_002938761.1 Galactosyl_T <168..>254 CDD:389837 30/90 (33%)
EEP 280..>361 CDD:382041 26/89 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.