DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and gzma

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:250 Identity:64/250 - (25%)
Similarity:98/250 - (39%) Gaps:35/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSEKL 157
            :.|.:.......|:.::....::..||.||....||||||.... |.:.:.|..|...||...  
Zfish    28 IVGGKDVKKALSWMVSIQVNQNHKCGGILIHKEWVLTAAHCKED-SYSSVTVLIGSLSLSKGS-- 89

  Fly   158 NPPMDRQVIKIMEH---EAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTFDRR---ICT 216
                  |.|.|..:   |.||..:..:|:.|:      .|...::.....||.|..|.:   .|.
Zfish    90 ------QRIAIHNYEIPETFNKKTKKDDIMLI------RLSKKVKAKPYKIPKKEKDVQPGTKCV 142

  Fly   217 VAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAGG-EEGRDVCSL 280
            |.|||.............|.:::.||:..:|.|.     ...|..:...::|||. ::.|..|..
Zfish   143 VRGWGTTDYKGKQASDKLQMLEVLVVDRVQCNRY-----YNRNPVITKDMLCAGNTQQHRGTCLG 202

  Fly   281 FGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSK-FMEWINPHLEQ 334
            ..|..|.|..:       ..|::|...|||....||.:|.:|| .:.|||..|:|
Zfish   203 DSGGPLECEKN-------LVGVLSGSHGCGDPKKPTVYTLLSKRHITWINKILKQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 60/241 (25%)
Tryp_SPc 95..328 CDD:214473 59/240 (25%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 62/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.