DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and TPSAB1

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:256 Identity:80/256 - (31%)
Similarity:125/256 - (48%) Gaps:31/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VFGDQTKP-NQFPWVTALFAKGSY---LGGGSLITPGLVLTAAHILAGLSPND---IMVRAGEWD 150
            :.|.|..| :::||..:|...|.|   ..|||||.|..||||||.: |....|   :.|:..|..
Human    31 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCV-GPDVKDLAALRVQLREQH 94

  Fly   151 LSSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTFDRRI- 214
            |...::|.|     |.:|:.|..|..:....|:|||.|:.|..:.:::.|:.||...:||...: 
Human    95 LYYQDQLLP-----VSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMP 154

  Fly   215 CTVAGWGMRSSTDVDIQ-------TIQQKVDLPVVESSKCQRQLRL-TKMGSNYQLPASLMCAGG 271
            |.|.|||     |||..       .::| |.:|::|:..|..:..| ...|.:.::....|...|
Human   155 CWVTGWG-----DVDNDERLPPPFPLKQ-VKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAG 213

  Fly   272 EEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWINPHL 332
            ...||.|....|..|.|.::   ..:.|||:||:|.||.|.|.|..:|.|:.:::||:.::
Human   214 NTRRDSCQGDSGGPLVCKVN---GTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 79/249 (32%)
Tryp_SPc 95..328 CDD:214473 78/248 (31%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 79/251 (31%)
Tryp_SPc 31..267 CDD:214473 78/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.