DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and Prss32

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_081496.2 Gene:Prss32 / 69814 MGIID:1917064 Length:334 Species:Mus musculus


Alignment Length:283 Identity:84/283 - (29%)
Similarity:138/283 - (48%) Gaps:38/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SKSPPQHSVDTLLRTSYPNALDGSPQ-----VFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGL 126
            |.||   |..|..|:...:::.|.|:     |.|...:..::||..::...|:::.|||||....
Mouse    27 SDSP---STTTGRRSIDLDSVCGRPRTSGRIVSGQDAQLGRWPWQVSVRENGAHVCGGSLIAEDW 88

  Fly   127 VLTAAHIL-AGLSPNDIMVRAGEWDLSSSEKLNPPMD-RQVIKIMEHEAFN---YSSGANDLALL 186
            ||||||.. .|.|.:...|..|  .:||..:.|.|.: |.|.:.::|.:::   :|||  |:||:
Mouse    89 VLTAAHCFNQGQSLSIYTVLLG--TISSYPEDNEPKELRAVAQFIKHPSYSADEHSSG--DIALV 149

  Fly   187 FLDSPFELRANIQTIRLPIPDKTFD-RRICTVAGWGMRSSTDVDIQTIQ--------QKVDLPVV 242
            .|.||......:..:.||.|....| ..:|.|.|||       .|.|.|        |::.:|::
Mouse   150 QLASPISFNDYMLPVCLPKPGDPLDPGTMCWVTGWG-------HIGTNQPLPPPFTLQELQVPLI 207

  Fly   243 ESSKCQRQLRLTKM-GSNYQLPASLMCAGGEEG-RDVCSLFGGFALFCSLDDDPNRYEQAGIVSF 305
            ::..|....:...: |:...:...::|||.:|| :|.|:...|..|.|.::|   .:.|||:||:
Mouse   208 DAETCNTYYQENSIPGTEPVILEGMLCAGFQEGKKDACNGDSGGPLVCDIND---VWIQAGVVSW 269

  Fly   306 GVGCGQANVPTTFTHVSKFMEWI 328
            |..|.....|..:|:||.::.||
Mouse   270 GSDCALFKRPGVYTNVSVYISWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 75/250 (30%)
Tryp_SPc 95..328 CDD:214473 73/248 (29%)
Prss32NP_081496.2 Tryp_SPc 53..292 CDD:214473 74/252 (29%)
Tryp_SPc 54..295 CDD:238113 76/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.