DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and zgc:123295

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:244 Identity:76/244 - (31%)
Similarity:120/244 - (49%) Gaps:24/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VFGDQTKPNQFPWVTALFAK--GSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSE 155
            |.|.......:||..:|.:.  |.:..|||||....||:|||.... |...|||:.|   |.|..
Zfish    37 VGGQNAGAGSWPWQVSLQSPTYGGHFCGGSLINKDWVLSAAHCFQD-SIGTIMVKLG---LQSQS 97

  Fly   156 KLNP-PMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTFDR-RICTVA 218
            ..|| .:.:.|::::.|..:|..|..||:||:.|||.......|:.:.|.....|:.. .:..|.
Zfish    98 GSNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTYAAGTLSWVT 162

  Fly   219 GWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNY--QLPASLMCAG--GEEGRDVCS 279
            |||..||....|..|.|:|::|:|..|.|:|.         |  ::.::::|||  .:.|:|.|.
Zfish   163 GWGKLSSAANQIPDILQEVEIPIVSHSDCKRA---------YPGEITSNMICAGLLDQGGKDSCQ 218

  Fly   280 LFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWI 328
            ...|..:   :..:.:::.|:||||||.||.:...|..:..||::.:||
Zfish   219 GDSGGPM---VSRNGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 75/242 (31%)
Tryp_SPc 95..328 CDD:214473 73/240 (30%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 74/242 (31%)
Tryp_SPc 36..264 CDD:238113 74/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587504
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.