DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and zgc:123217

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:254 Identity:70/254 - (27%)
Similarity:111/254 - (43%) Gaps:29/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWDL------ 151
            |.|.......:||..::.....::.||:||....|:||||.:...:.|       .|.|      
Zfish    38 VGGTDAPAGSWPWQVSIHYNNRHICGGTLIHSQWVMTAAHCIINTNIN-------VWTLYLGRQT 95

  Fly   152 SSSEKLNPPMDRQVIK-IMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTF-DRRI 214
            .|:...||...:..|: |::|.:||.|...||::|:.|..|......|:.|.|...:..| :...
Zfish    96 QSTSVANPNEVKVGIQSIIDHPSFNNSLLNNDISLMKLSQPVNFSLYIRPICLAANNSIFYNGTS 160

  Fly   215 CTVAGWGMRSSTDVDI---QTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAGGEEGRD 276
            |...||| ....|..:   ||:|| |.:|||.:|.|..:....   :|..:...::|| |:..:.
Zfish   161 CWATGWG-NIGKDQALPAPQTLQQ-VQIPVVANSLCSTEYESV---NNATITPQMICA-GKANKG 219

  Fly   277 VCSLFGGFALFCSLDDDPNRYEQAGIVSFG--VGCGQANVPTTFTHVSKFMEWINPHLE 333
            .|....|....|.   ..:.:.||||.|:|  .||.....|..::.||:|..||..:::
Zfish   220 TCQGDSGGPFQCK---QGSVWIQAGITSYGTSAGCAVGAYPDVYSRVSEFQSWIKMNVQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 68/246 (28%)
Tryp_SPc 95..328 CDD:214473 67/245 (27%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 68/247 (28%)
Tryp_SPc 37..273 CDD:238113 70/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.