DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG34458

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:283 Identity:73/283 - (25%)
Similarity:115/283 - (40%) Gaps:59/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SDEEVCCEKSNVIGMSKSPPQHSVDTLLRTSYPNALDGSPQVFGDQTKPNQFPWVTALFAKGSYL 116
            ||.:| .|:|.:||                             |....|.|||...:|...|.:.
  Fly    22 SDMDV-AEESRIIG-----------------------------GQFAAPGQFPHQVSLQLNGRHH 56

  Fly   117 GGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWDLS--SSEKLNPPMDRQVIKIMEHEAFNYSSG 179
            .|||||:..:::||||...|.:|..:....|..|||  :.:..|      :.:.:.|..:|..|.
  Fly    57 CGGSLISDTMIVTAAHCTMGQNPGQMKAIVGTNDLSAGNGQTFN------IAQFIIHPRYNPQSQ 115

  Fly   180 ANDLALLFLDSPFELRANIQTIRLPIPDKTFDR-RICTVAGWGMRSSTDVDIQTIQQKVDLPVVE 243
            ..|::|:.|.||..:...:|||:|...|..:.. .:..::|:|          .|.|.:.|| ..
  Fly   116 DFDMSLIKLSSPVPMGGAVQTIQLADSDSNYAADTMAMISGFG----------AINQNLQLP-NR 169

  Fly   244 SSKCQRQLRLTKMGSNYQLPA---SLMCAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSF 305
            ....|.||......::..:|.   .::|||...|: |.|..|......::|.     :..|:||:
  Fly   170 LKFAQVQLWSRDYCNSQNIPGLTDRMVCAGHPSGQ-VSSCQGDSGGPLTVDG-----KLFGVVSW 228

  Fly   306 GVGCGQANVPTTFTHVSKFMEWI 328
            |.|||....|..:|:|.....||
  Fly   229 GFGCGAKGRPAMYTYVGALRSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 66/240 (28%)
Tryp_SPc 95..328 CDD:214473 64/238 (27%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 66/271 (24%)
Tryp_SPc 32..254 CDD:238113 68/272 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.