DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and Tpsab1

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:247 Identity:81/247 - (32%)
Similarity:121/247 - (48%) Gaps:22/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VFGDQTKPNQFPWVTALFAKGSY---LGGGSLITPGLVLTAAHILA--GLSPNDIMVRAGEWDLS 152
            |.|.:...|::||..:|....:|   ..|||||.|..||||||.:.  ...||.:.|:..:..|.
  Rat    67 VGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQWVLTAAHCVGPNKADPNKLRVQLRKQYLY 131

  Fly   153 SSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTF-DRRICT 216
            ..:.|     ..|.:|:.|..|..:....|:|||.|.:|..:.:|:.|:.||...:|| ...:|.
  Rat   132 YHDHL-----LTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSLPPASETFPSGTLCW 191

  Fly   217 VAGWGMRSSTDVDIQT--IQQKVDLPVVESSKCQRQLRLTK---MGSNYQLPASLMCAGGEEGRD 276
            |.||| ..:.||.:..  ..::|.:|:||:..|  .|:..|   .|.|..:....|...|.||.|
  Rat   192 VTGWG-NINNDVSLPPPFPLEEVQVPIVENRLC--DLKYHKGLNTGDNVHIVRDDMLCAGNEGHD 253

  Fly   277 VCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWI 328
            .|....|..|.|.::|   .:.|||:||:|.||.|.|.|..:|.|:.:::||
  Rat   254 SCQGDSGGPLVCKVED---TWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 80/245 (33%)
Tryp_SPc 95..328 CDD:214473 78/243 (32%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 79/245 (32%)
Tryp_SPc 66..302 CDD:238113 79/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.