DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and prss60.2

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:268 Identity:79/268 - (29%)
Similarity:131/268 - (48%) Gaps:38/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NALDGSPQVFGDQTKPNQFPWVTALFAK--GSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRAG 147
            ||.:||            :||..:|.:.  |.:..|||||:...||||||.|.|:|.:.::|..|
Zfish    39 NAPEGS------------WPWQVSLQSPRYGGHFCGGSLISSEWVLTAAHCLPGVSESSLVVYLG 91

  Fly   148 EWDLSSSEKLNP-PMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTFD 211
            .   .:.:.:|. ...|.|.||:.|.::|.::..||:|||.|.|.......|:.:.|...:..:.
Zfish    92 R---RTQQGVNTHETSRNVAKIIVHSSYNSNTNDNDIALLRLSSAVTFNDYIRPVCLAAQNSVYS 153

  Fly   212 RRICT-VAGWG-MRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAG-GEE 273
            ....: :.||| :::..::....|.|:..:|||.:.:|..||....:.:|      ::||| .:.
Zfish   154 AGTSSWITGWGDVQAGVNLPAPGILQETMIPVVANDRCNAQLGSGTVTNN------MICAGLAKG 212

  Fly   274 GRDVCSLFGGFAL---FCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWINPHLEQV 335
            |:|.|....|..:   .|::      :.||||.|:|.||...|.|..:|.||::..||:..:.| 
Zfish   213 GKDTCQGDSGGPMVTRLCTV------WIQAGITSWGYGCADPNSPGVYTRVSQYQSWISSKISQ- 270

  Fly   336 LSVPGNML 343
             :.||.:|
Zfish   271 -NQPGFIL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 70/242 (29%)
Tryp_SPc 95..328 CDD:214473 69/241 (29%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 73/251 (29%)
Tryp_SPc 34..267 CDD:238113 75/254 (30%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587618
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.