DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG11313

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:387 Identity:101/387 - (26%)
Similarity:160/387 - (41%) Gaps:77/387 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLCTSLVIILGLILSSGGTHI-----------CLSSNLCVP------RENCRE-EMPFFDFSSTI 49
            ::..::::.|.:|.::.|.::           |::..||||      :.|..: ||.|...|..:
  Fly     2 KVIAAVLLCLLIIRTAHGQYVSCRNPNQRTGYCVNIPLCVPLNSVLAKSNPTDSEMRFIRESRCL 66

  Fly    50 ECSDEE----VCCEKSNVIGMSKSPPQHSV--DTLLRTSYPN-ALDGSPQVFGDQTKPN-----Q 102
             .||:.    |||........:::.|...|  .|||    |: ::.|....:...||.|     :
  Fly    67 -VSDQSDLPFVCCTPDTDYNTTRARPNDEVIHSTLL----PDRSICGGDIAYNQITKGNETVLTE 126

  Fly   103 FPWVTALFAK---GSYLG---GGSLITPGLVLTAAHILAGLS---PND----IMVRAGEWDLS-- 152
            |.|:..|..:   |..|.   .||||....|:||||.::..:   ..|    :.||.||.:.|  
  Fly   127 FAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAV 191

  Fly   153 ----SSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPI-------- 205
                :...|..|:...|.:|..||:|......||:||:.|........:|:.:.||.        
  Fly   192 VDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQ 256

  Fly   206 PDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAG 270
            ..:.|     |||||| |:.|. :...::.|:.:..||...|:|     |..|...|..|.:||.
  Fly   257 SGQAF-----TVAGWG-RTLTS-ESSPVKMKLRVTYVEPGLCRR-----KYASIVVLGDSHLCAE 309

  Fly   271 GEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWINPHL 332
            |....|.|....|..|....:   ..:...||||||:.||....|..:|:|..:..||..::
  Fly   310 GRSRGDSCDGDSGGPLMAFHE---GVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQNI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 75/265 (28%)
Tryp_SPc 95..328 CDD:214473 74/264 (28%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855 13/54 (24%)
Tryp_SPc 116..367 CDD:238113 76/265 (29%)
Tryp_SPc 116..364 CDD:214473 74/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457338
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.