DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and aqrs

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:227 Identity:43/227 - (18%)
Similarity:75/227 - (33%) Gaps:95/227 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRLCTSLVIILGLILSSGGTHICLSSNLCVPRENCREEMPFF-----------DFSSTIECSDE 54
            |..|.|.::.|||:         ..|::|.:.:.:.....|.:           |::.  |..:|
  Fly     1 MRLLFTCILSILGM---------DYSASLWIKKYSENYHRPTYYNRAHRTKDHVDYNR--EALEE 54

  Fly    55 EVCCEKSNVIGMSKSPPQHSVDTLLRTSYPNALDGSPQVFGDQTKPNQFPWVTALFAKGSYLGGG 119
            .   :|...:.:.|..|..:...|  |.|.|.|:                       :||.:..|
  Fly    55 R---DKPKPVEVQKRLPFDATRDL--TYYVNVLN-----------------------EGSVICAG 91

  Fly   120 SLITPGLVLTAAH-------------------ILAGLSPNDIMVRAGEWDLSSSEKLNPPMDRQV 165
            :||:..:|:|:.|                   ||.|:..:|                 .|...||
  Fly    92 ALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTGVELDD-----------------NPEPHQV 139

  Fly   166 I----KIMEHEAFNYSSGANDLALLFLDSPFE 193
            |    .:.::|.|     .|.:|||.|.:..:
  Fly   140 IGFFMPVNKNERF-----TNYVALLALSNKLD 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 23/122 (19%)
Tryp_SPc 95..328 CDD:214473 23/122 (19%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 24/130 (18%)
Tryp_SPc 83..268 CDD:304450 23/129 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.