DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG7142

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:288 Identity:85/288 - (29%)
Similarity:121/288 - (42%) Gaps:68/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 PNQFPWVTALFAK-------GSYLGGGSLITP--GLV-------------LTAAHILAGLSP--- 139
            |.|..|.....||       ..|:....::||  |||             |||||.|:  ||   
  Fly    71 PRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLS--SPQAV 133

  Fly   140 -NDIMVRAGEWDL--SSSEKLNPPMDRQVIKIMEHEAFNYSSGAN--DLALLFLDSPFELRANIQ 199
             |.::| ||..|:  ...|..|..| |.:...:.||.  |..|.|  |:||::...|......:|
  Fly   134 ENSVIV-AGSHDIHDQKGEASNIQM-RHIDYYVRHEL--YLGGVNPYDIALIYTKEPLVFDTYVQ 194

  Fly   200 TIRLPIPDKTFDRRICTVAGWGMRSSTDV-DIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLP 263
            ...||..|.. .....|:.|||..|.|.| :.....|:.::|:::...|::.|    ..|...|.
  Fly   195 PATLPEQDAQ-PEGYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQIL----ARSGLPLH 254

  Fly   264 ASLMCAGGEEGRDVCSLFGGFALFCSLDDD--------PNRYEQA----GIVSFG-VGCGQANVP 315
            .:.:|.|        .|.||.:: |:.|..        ...:|||    ||||:| :.|||.|.|
  Fly   255 ETNLCTG--------PLTGGVSI-CTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAP 310

  Fly   316 TTFTHVSKFMEWINPHLEQVLSVPGNML 343
            :.|..||.|.||||    ||:|...:::
  Fly   311 SVFVRVSAFTEWIN----QVISTATHIM 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 80/272 (29%)
Tryp_SPc 95..328 CDD:214473 79/271 (29%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 77/265 (29%)
Tryp_SPc 84..323 CDD:214473 74/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.