DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG31266

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:247 Identity:65/247 - (26%)
Similarity:103/247 - (41%) Gaps:31/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PQ---VFGDQTKPNQFPWVTALFAKGSY-LGGGSLITPGLVLTAAHILAGLSPNDIMVRAGE--- 148
            ||   :.|.......:||:.::....|| |.|..::....|||||..:|||.|.:::|..|.   
  Fly    48 PQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDW 112

  Fly   149 WDLSSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTFDRR 213
            |||.:..       ..|.:|..|..|:.....||:|||.|.|..|.....:.|.|...|:..:..
  Fly   113 WDLYAPY-------YTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGD 170

  Fly   214 ICTVAGWGMRSSTDVDIQTIQQK--VDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAGGEEGRD 276
            ..|.||||...:.....:.:|:.  ..|||   ..|:.:|:     :...:....:|...:.|:.
  Fly   171 KLTFAGWGSSEAMGTYGRYLQEASGTYLPV---DACREKLQ-----NQDDVDLGHVCVQMDAGQG 227

  Fly   277 VCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWI 328
            .|....|..|.    |:..|.  .||.::||.||: ..|..:...:.:.:||
  Fly   228 ACHGDTGGPLI----DEQQRL--VGIGNWGVPCGR-GYPDVYARTAFYHDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 63/240 (26%)
Tryp_SPc 95..328 CDD:214473 61/238 (26%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 61/242 (25%)
Tryp_SPc 52..275 CDD:238113 63/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.