DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG14892

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:373 Identity:76/373 - (20%)
Similarity:114/373 - (30%) Gaps:156/373 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VFGDQTKPNQFPWVTALFAKGSYLG------GGSLITPGLVLTAAHILAGLSPNDIM-------- 143
            :.|..|...||||..:|......||      |..||....:|:|||.:    .||:.        
  Fly    82 IAGAATNEGQFPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCV----HNDLFNLPIPPLW 142

  Fly   144 -VRAGEW--DLSSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFEL--RANIQTIRL 203
             |..||.  |:.|..:...|:::.|   |.|...|:.   :|:.|:.|..|.:|  .:||:.|.|
  Fly   143 TVVLGEHDRDVESGNEQRIPVEKIV---MHHRYHNFK---HDVVLMKLSKPADLTRASNIRRICL 201

  Fly   204 P----------------------------------IPDK--TFDRRI------------------ 214
            |                                  :|:|  .|.|.:                  
  Fly   202 PFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELM 266

  Fly   215 -------------------------------------------------------------CTVA 218
                                                                         |...
  Fly   267 NMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVAT 331

  Fly   219 GWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAG---GEEGRDVCSL 280
            ||| :::...|:.....|..:|:.::.:|:     ...||...:....:|||   ||.|  .|..
  Fly   332 GWG-KANISGDLSNQLLKTQVPLHQNGRCR-----DAYGSFVNIHGGHLCAGKLNGEGG--TCVG 388

  Fly   281 FGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWI 328
            ..|..|.|.|..| ..:...|:.|||.||.....|..:|..|.:|:||
  Fly   389 DSGGPLQCRLSRD-GPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWI 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 76/371 (20%)
Tryp_SPc 95..328 CDD:214473 74/369 (20%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 74/371 (20%)
Tryp_SPc 81..438 CDD:238113 76/373 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.