DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG3916

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:268 Identity:70/268 - (26%)
Similarity:115/268 - (42%) Gaps:41/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 TSYPNALDGSPQVFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVR 145
            |..|..::|..:|  ::|.|.|.........:..:..|||:::...||||||.:..:...|:.|.
  Fly    25 TESPTRINGGQRV--NETVPFQVSLQMQRRGRWQHFCGGSIVSGQHVLTAAHCMEKMKVEDVSVV 87

  Fly   146 AG--EWDLSSSEKLNPPMDRQVIKIMEHEAFNYSSG---ANDLALLFLDSPFEL-RANIQTIRLP 204
            .|  .|      |......|.|.|   |....||..   .||:||:.:..||.| |::|.||.:.
  Fly    88 VGTLNW------KAGGLRHRLVTK---HVHPQYSMNPRIINDIALVKVTPPFRLERSDISTILIG 143

  Fly   205 IPDKTFDRRICTVAGWGMR--SSTDVDIQTIQQKVDLPVVESSKC-QRQLRLTKMGSNYQLPASL 266
            ..|:..::....:.|||..  |::...:....|.::...:.:..| |:..|:|:         :.
  Fly   144 GSDRIGEKVPVRLTGWGSTSPSTSSATLPDQLQALNYRTISNEDCNQKGFRVTR---------NE 199

  Fly   267 MCAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQ-AGIVSFGVG-CGQANVPTTFTHVSKFMEWIN 329
            :||...:|:..|....|..|.     .|.:... .||||:|.. |.|.. |..:|.||.|:    
  Fly   200 ICALAVQGQGACVGDSGGPLI-----RPGKQPHLVGIVSYGSSTCAQGR-PDVYTRVSSFL---- 254

  Fly   330 PHLEQVLS 337
            |::.||::
  Fly   255 PYISQVIN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 63/244 (26%)
Tryp_SPc 95..328 CDD:214473 63/243 (26%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 66/256 (26%)
Tryp_SPc 31..260 CDD:238113 66/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.