DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG4613

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:303 Identity:91/303 - (30%)
Similarity:144/303 - (47%) Gaps:54/303 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SNVIGMSKSPPQHSVDTLLRTSYPNALD-----------------------GSPQ----VFGDQT 98
            |||:|::...|..:..:|..||..::..                       |.|.    |.|.|.
  Fly    79 SNVLGVASETPSDTASSLGSTSLSSSASPVFPLEGGGAKAFRVNRCASCTCGVPNVNRIVGGTQV 143

  Fly    99 KPNQFPWVTALFAKGSYL-GGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSEKLNPPMD 162
            :.|::||: |...:|::| .||:||....||||||.:.|:....:.||..:.|.||:   :..:.
  Fly   144 RTNKYPWI-AQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSST---HLGVT 204

  Fly   163 RQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLP--IPD---KTFDRRICTVAGWGM 222
            |.|.....|..::..|..:|:|||.||.|..|   :.|:| |  :|.   :.||.:...|||||:
  Fly   205 RSVAFAHAHVGYDPVSLVHDIALLRLDQPIPL---VDTMR-PACLPSNWLQNFDFQKAIVAGWGL 265

  Fly   223 RSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAGGEE--GRDVCSLFGGFA 285
             |.......::.|:|.:|::.:::|    |.|...|  .:..::||||..:  |||.|....|..
  Fly   266 -SQEGGSTSSVLQEVVVPIITNAQC----RATSYRS--MIVDTMMCAGYVKTGGRDACQGDSGGP 323

  Fly   286 LFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWI 328
            |...    ...:..||:||||.||.:.:.|..:|.||:::|||
  Fly   324 LIVR----DRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 80/242 (33%)
Tryp_SPc 95..328 CDD:214473 78/240 (33%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 79/244 (32%)
Tryp_SPc 137..362 CDD:238113 79/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457680
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.