DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG6462

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:256 Identity:68/256 - (26%)
Similarity:102/256 - (39%) Gaps:46/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GDQTKPNQFPWVTALFAK--GSYL--GGGSLITPGLVLTAAHILAGLSPNDIMVRAGEW-DLSSS 154
            |:......||:...|..:  |:.|  .||||||...||||||.|.......|...|..: |:..|
  Fly    80 GELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFADVEDS 144

  Fly   155 EKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLP---IPDKTFDRRICT 216
            .:......|..|...::..|   .|.:||||:.|.........:|.|.|.   :.......::.|
  Fly   145 VEELQVTHRDFIIYPDYLGF---GGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVT 206

  Fly   217 VAGWG-MRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASL-----MCAGGEEGR 275
            ::||| :..|||...:.:|. :|..|::..:|          ..|.||..:     :|..|..||
  Fly   207 LSGWGYLGDSTDKRTRLLQY-LDAEVIDQERC----------ICYFLPGLVSQRRHLCTDGSNGR 260

  Fly   276 DVCSLFGGFALFCSLDDDPNRYE------QAGIVSFG--VGCGQANVPTTFTHVSKFMEWI 328
            ..|:...|         .|..|.      ..|:.|||  .|| :...||.:|.::.::.||
  Fly   261 GACNGDSG---------GPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 68/256 (27%)
Tryp_SPc 95..328 CDD:214473 66/254 (26%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 66/254 (26%)
Tryp_SPc 77..314 CDD:238113 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457608
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.