DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG14990

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:304 Identity:131/304 - (43%)
Similarity:190/304 - (62%) Gaps:25/304 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FSSTIECSDEEVCCEKSNVIGMSKSPPQHSVDTLLRTSYPNALDGSPQVFGDQTKPNQFPWVTAL 109
            |:..::....:||       |||.               ||.|..:.:|..|.:.|.|||||.||
  Fly    36 FTENLQPDPNQVC-------GMSN---------------PNGLVANVKVPKDYSTPGQFPWVVAL 78

  Fly   110 FAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAF 174
            |::|.|.|.||||.|.:|||||.|:.|.:..:|:||||||:.....:..|..||.|.::::|..|
  Fly    79 FSQGKYFGAGSLIAPEVVLTAASIVVGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREF 143

  Fly   175 NYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDL 239
            :|..|||::|||||.:||||:::|:||.||...::||::.|.|.|||..:..|.:...||:|::|
  Fly   144 SYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIEL 208

  Fly   240 PVVESSKCQRQLRLTKMGSNYQLPASLMCAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVS 304
            |::..::||.|||.|::|.::.|||||:|||||:....|...||.||||.::.||:||||||||:
  Fly   209 PMINRAQCQDQLRNTRLGVSFDLPASLICAGGEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVN 273

  Fly   305 FGVGCGQANVPTTFTHVSKFMEWINPHLEQ-VLSVP--GNMLPA 345
            :|:||.:.|||..:|:|..|.:||..|:.| ..|||  ...||:
  Fly   274 WGIGCQEENVPAVYTNVEMFRDWIYEHMAQNSNSVPFAAGQLPS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 113/233 (48%)
Tryp_SPc 95..328 CDD:214473 112/232 (48%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 113/232 (49%)
Tryp_SPc 67..297 CDD:214473 111/229 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471501
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27566
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.