DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG9294

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:254 Identity:85/254 - (33%)
Similarity:137/254 - (53%) Gaps:21/254 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSEKL 157
            |.|.:|:.:|:||:..:.....:...||||....||||||.:.|:.|..|.:|..|.:.|.|.. 
  Fly   102 VGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPPELITLRFLEHNRSHSND- 165

  Fly   158 NPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRAN-IQTIRLPIPDKTFDRRICTVAGWG 221
            :..:.|.|.::..||.:|..|..||||:|.|:.|.::|.: ::.|.||:...:||..:..|||||
  Fly   166 DIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSFDHELGIVAGWG 230

  Fly   222 MRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNY---QLPASLMCAG--GEEGRDVCSLF 281
            .:........|::: ||:.|:..|:|:.       |:.|   |:..::||||  .|.|:|.||..
  Fly   231 AQREGGFGTDTLRE-VDVVVLPQSECRN-------GTTYRPGQITDNMMCAGYISEGGKDACSGD 287

  Fly   282 GGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWINPHLEQVLSVPG 340
            .|..|..:.|:.|.:|:.|||||:||||.:...|..:|.|::::.|:..      :.||
  Fly   288 SGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGS------NTPG 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 82/239 (34%)
Tryp_SPc 95..328 CDD:214473 81/238 (34%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 82/239 (34%)
Tryp_SPc 101..334 CDD:238113 82/240 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457678
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.