DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and Prss48

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:269 Identity:68/269 - (25%)
Similarity:122/269 - (45%) Gaps:49/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPN---DIMVRAGEWDLSSS 154
            |.|......::||..:|....::..|||||:...||||||.:.....:   .:.:.:.:.:.||:
Mouse    41 VGGQDAALGRWPWQVSLRFDYTHSCGGSLISDHWVLTAAHCIKKTWYSFLYSVWLGSIDREYSST 105

  Fly   155 EKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTFDRRI----- 214
            .|     :..|.:|...:...::..  |:|||.|.|    |....::.|||......:::     
Mouse   106 GK-----EYYVSRIAIPDKHRHTEA--DIALLKLSS----RVTFSSVILPICLPNISKQLTVPAS 159

  Fly   215 CTVAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQL------------RLTKMGSNYQLPASLM 267
            |.|.|||  .:.:....:..|::::||:.|..|: ||            |:.|        ..:.
Mouse   160 CWVTGWG--QNQEGHYPSTLQELEVPVISSEACE-QLYNPIGVFLPDLERVIK--------EDMF 213

  Fly   268 CAGGEEGR-DVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWINPH 331
            |||..:.| |.|....|..|.|.:|   ..:...|:||:|:.||: ::|..:|:|:.:.:||:..
Mouse   214 CAGERQSRKDSCKGDSGGPLSCHID---GVWRLMGVVSWGLECGK-DLPGVYTNVTYYQKWISAI 274

  Fly   332 LEQVLSVPG 340
            :.:  :.||
Mouse   275 ISR--APPG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 64/254 (25%)
Tryp_SPc 95..328 CDD:214473 63/253 (25%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 64/255 (25%)
Tryp_SPc 40..274 CDD:238113 66/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.