DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG8172

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:334 Identity:90/334 - (26%)
Similarity:147/334 - (44%) Gaps:69/334 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FFDFSSTIECSDEEVCCEKSNVIGMSKSPPQH---------SVDTLLRTSYPNALD--------- 88
            |||             .|....:..:.:||.|         :|..:|..:...|.|         
  Fly   243 FFD-------------AESQAPLDSAGAPPPHEPLPNAQAFAVGNVLDLNAGEAADEYQSGGSGG 294

  Fly    89 ----------GSPQVF--------GDQTKPNQFPWVTALFAKGSYLG-----GGSLITPGLVLTA 130
                      |..:|:        |..|.....||..||. |..:|.     ||:||:...|:||
  Fly   295 YHDASYRPVPGCGEVYTRSNRIVGGHSTGFGSHPWQVALI-KSGFLTRKLSCGGALISNRWVITA 358

  Fly   131 AHILAGLSPNDIMVRAGEWDL-SSSEKLNPP---MDRQVIKIMEHEAFNYSSGANDLALLFLDSP 191
            ||.:|....:::.:|.||||: ...|:||..   ::|:.:    |..:|.:...||:||:.||..
  Fly   359 AHCVASTPNSNMKIRLGEWDVRGQEERLNHEEYGIERKEV----HPHYNPADFVNDVALIRLDRN 419

  Fly   192 FELRANIQTIRLPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKM 256
            ...:.:|..:.||........::.||||||........:.::.|:||:.|:.:.:|||..|..  
  Fly   420 VVYKQHIIPVCLPPSTTKLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAA-- 482

  Fly   257 GSNYQLPASLMCAGGEE-GRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTH 320
            |....:....:|||.:: |||.|....|..|..::|   .|....|:||:|:|||:.::|..:|:
  Fly   483 GRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMD---GRKTLIGLVSWGIGCGREHLPGVYTN 544

  Fly   321 VSKFMEWIN 329
            :.:|:.|||
  Fly   545 IQRFVPWIN 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 75/243 (31%)
Tryp_SPc 95..328 CDD:214473 74/242 (31%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 74/246 (30%)
Tryp_SPc 316..555 CDD:238113 77/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457552
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.