DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and flz

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:333 Identity:92/333 - (27%)
Similarity:146/333 - (43%) Gaps:60/333 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SSTIEC--------SDEEVCCEKSNVIGMSKSPPQHSVD---TLLRTSY---------------- 83
            |||::.        :|:|:..|:... .::.:|..:.:|   ||  :||                
  Fly  1364 SSTVKTTTVSSARPADDEIVDEEDEE-DVNPNPSDNEIDQGATL--SSYGGANGRKIHSTSRTLP 1425

  Fly    84 -PNALDGSPQ--------------VFGDQTKPNQFPWVTALFAKGSYLG-------GGSLITPGL 126
             ||....||.              |.|..:....:|| ..|..:.::||       ||.|||...
  Fly  1426 TPNLAFHSPSTECGVRPHVKSGRIVGGKGSTFGAYPW-QVLVRESTWLGLFTKNKCGGVLITSRY 1489

  Fly   127 VLTAAHILAGLSPNDIMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSP 191
            |:||||...|...:.:.| .||:|:|...:....:.:.|.:::.|..::.::..||||||.||||
  Fly  1490 VITAAHCQPGFLASLVAV-MGEFDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSP 1553

  Fly   192 FELRANIQTIRLPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKM 256
            .:...:|..|.:|.....|..|:.||.||| |......:.::.|:|.:|::|:|.||......  
  Fly  1554 VQFDTHIVPICMPNDVADFTGRMATVTGWG-RLKYGGGVPSVLQEVQVPIIENSVCQEMFHTA-- 1615

  Fly   257 GSNYQLPASLMCAGGEEG-RDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTH 320
            |.|.::..|.:|||...| :|.|....|..|.....|  .|||.||.||.|:.|....:|..:..
  Fly  1616 GHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPD--GRYELAGTVSHGIKCAAPYLPGVYMR 1678

  Fly   321 VSKFMEWI 328
            .:.:..|:
  Fly  1679 TTFYKPWL 1686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 75/242 (31%)
Tryp_SPc 95..328 CDD:214473 74/240 (31%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 76/245 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457720
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.