DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and SPH93

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:238 Identity:117/238 - (49%)
Similarity:162/238 - (68%) Gaps:2/238 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 DQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSEKLNPP 160
            ||.:|.|:||..|:|..|.||.|||||.|.:|||.||.:..:. .:::||||:|||.|..::...
  Fly   250 DQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIE-TELVVRAGDWDLKSDREIFLS 313

  Fly   161 MDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTFDRRICTVAGWGMRSS 225
            ..|:|.:.:.||.|::.||||:||||||:|||:|..:|:||.||.|:|:|..|.|||||||....
  Fly   314 EQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPTPNKSFAGRRCTVAGWGKMRY 378

  Fly   226 TDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAGGEEGRDVCSLFGGFALFCSL 290
            .|....|:.:||.|.||..:.|::.||.|::|:.::||.:::|||||.|||.|:..||.|||||:
  Fly   379 EDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSI 443

  Fly   291 -DDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWINPHL 332
             .::...|||||||::||||||..:|..:|.||||..||...|
  Fly   444 GGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWITEKL 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 115/233 (49%)
Tryp_SPc 95..328 CDD:214473 114/232 (49%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 116/235 (49%)
Tryp_SPc 252..482 CDD:214473 112/230 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471502
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.