DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG3355

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:258 Identity:90/258 - (34%)
Similarity:137/258 - (53%) Gaps:26/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 TSYPNALDGSPQ----VFGDQTKPNQFPWVTALFAKGSY----LGGGSLITPGLVLTAAHILAGL 137
            |:..|...|:|.    |.|.|.:.|::|| ||...||.:    ..|||||....||||||.:.| 
  Fly    61 TAKQNCFCGTPNVNRIVGGQQVRSNKYPW-TAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHG- 123

  Fly   138 SPNDIMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIR 202
            :.:.|.:|..:.|.||.:   |.:.|:|::...|..::.:...||:|||.|:||..|..|::.:.
  Fly   124 NRDQITIRLLQIDRSSRD---PGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVC 185

  Fly   203 LPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLM 267
            ||..:..||.:...|||||:.....|....:|: |::||:.:::| ||.|...     ::...::
  Fly   186 LPEANHNFDGKTAVVAGWGLIKEGGVTSNYLQE-VNVPVITNAQC-RQTRYKD-----KIAEVML 243

  Fly   268 CAG--GEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWI 328
            |||  .:.|:|.|....|..|..    :..||:.||:||||.||.|.|.|..:..||||::||
  Fly   244 CAGLVQQGGKDACQGDSGGPLIV----NEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 85/240 (35%)
Tryp_SPc 95..328 CDD:214473 83/238 (35%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 84/242 (35%)
Tryp_SPc 76..305 CDD:238113 86/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457676
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.