DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and prss60.3

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:260 Identity:76/260 - (29%)
Similarity:126/260 - (48%) Gaps:26/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VFGDQTKPNQFPWVTALFAK--GSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSE 155
            |.|....|..:||..:|.:.  |.:..|||||:...||||||.|:|:|...::|..|.   .:.:
Zfish    37 VGGVNASPGSWPWQVSLHSPKYGGHFCGGSLISSEWVLTAAHCLSGVSETTLVVYLGR---RTQQ 98

  Fly   156 KLN-PPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTFDRRICT-VA 218
            .:| ....|.|.|...|.::|.::..||:|||.|.|.......|:.:.|...:..:.....: :.
Zfish    99 GINIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLAAQNSVYSAGTSSWIT 163

  Fly   219 GWG-MRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAG-GEEGRDVCSLF 281
            ||| :::..::....|.|:..:|||.:.:|...|....:.:|      ::||| .:.|:|.|...
Zfish   164 GWGDIQAGVNLPAPGILQETMIPVVANDRCNALLGSGTVTNN------MICAGLTQGGKDTCQGD 222

  Fly   282 GGFAL---FCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWINPHLEQVLSVPGNML 343
            .|..:   .|::      :.||||.|:|.||...|.|..:|.||::..||:..:.  |:.||.:|
Zfish   223 SGGPMVTRLCTV------WVQAGITSWGYGCADPNSPGVYTRVSQYQSWISSKIS--LNKPGFIL 279

  Fly   344  343
            Zfish   280  279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 70/242 (29%)
Tryp_SPc 95..328 CDD:214473 69/241 (29%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 72/246 (29%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587617
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.