DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG4259

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:263 Identity:91/263 - (34%)
Similarity:134/263 - (50%) Gaps:23/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 TLLRTSYPNALDGSPQVFGDQTKPNQFPWVTALFAKGS----YLGGGSLITPGLVLTAAHILAGL 137
            :|:.:.|.|......:.:|...:.. ||||.::..:..    |:|.||||.|.:||||||||.|.
  Fly    14 SLVNSQYFNYNQIRRETYGSNPRAT-FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGT 77

  Fly   138 SPNDIMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIR 202
            :..|::|||||||.|::.. ...:|.:|:.|:.||.||..:..|::|||.|.|.||:.|||..|.
  Fly    78 TKYDLVVRAGEWDTSTTAD-QQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIP 141

  Fly   203 LPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLM 267
            |.:.:....:..|...|||.......|..|:.:.|.:.::....|          |:.:||...:
  Fly   142 LYLQEAGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMC----------SSRKLPIQQI 196

  Fly   268 CAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTT---FTHVSKFMEWIN 329
            |..|.||.| ||..||..|.|.:...|.:|.|.|||::   ..|..|..|   ||:|:..:.||:
  Fly   197 CGKGLEGID-CSGDGGAPLVCRILTYPYKYAQVGIVNW---LSQKPVENTFIVFTNVAGLLPWID 257

  Fly   330 PHL 332
            .||
  Fly   258 YHL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 85/240 (35%)
Tryp_SPc 95..328 CDD:214473 84/239 (35%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 85/234 (36%)
Tryp_SPc 39..256 CDD:214473 83/231 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471518
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.