DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG4653

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:253 Identity:74/253 - (29%)
Similarity:105/253 - (41%) Gaps:46/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PQVFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILA------GLSPNDIMVRAGEW 149
            |...|.|      |...:|...|.::.||:||....:|||||.::      ........||.|..
  Fly    30 PAEVGSQ------PHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSI 88

  Fly   150 DLSSSEKLNPPMDRQVIKIMEHEAFNYSS----GANDLALLFLDSPFELRANIQTIRLPIPDKTF 210
            ...:..:|.|     :.||:.|.  ||||    |:||||||.|::...|.||...|.|.......
  Fly    89 QRLTGGQLVP-----LSKIIIHT--NYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAA 146

  Fly   211 DRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAGGEEGR 275
            ..:| ..:||| .|..|..:..:.|......:.:|.||.:|        |.....|:|       
  Fly   147 GSQI-IFSGWG-SSQVDGSLSHVLQVATRQSLSASDCQTEL--------YLQQEDLLC------- 194

  Fly   276 DVCSLFGGFALFCSLD-DDPNRY--EQAGIVSFGV-GCGQANVPTTFTHVSKFMEWIN 329
             :..:...||..||.| ..|..|  :..||.:|.| ||| :..|..:..|::.:||||
  Fly   195 -LSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCG-SEQPDGYVDVTQHLEWIN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 71/247 (29%)
Tryp_SPc 95..328 CDD:214473 70/246 (28%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 74/253 (29%)
Tryp_SPc 30..249 CDD:214473 71/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457603
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.