DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG9673

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:271 Identity:69/271 - (25%)
Similarity:116/271 - (42%) Gaps:56/271 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 DGSPQ---VFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILA--GLSPND---IMV 144
            :.|||   :.|:.....::||..::....:::..|::|:...:|||||.::  |::|.|   :.|
  Fly    22 EASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAV 86

  Fly   145 RAGEWDLSSSEKLNPPMDRQVIKIME---HEAFNYSSGANDLALLFLDSPFELRANIQTIRLP-- 204
            |.|        .:|......::.:..   |.  :|.:..:|:|:|.||........||.|.||  
  Fly    87 RLG--------TINQYAGGSIVNVKSVIIHP--SYGNFLHDIAILELDETLVFSDRIQDIALPPT 141

  Fly   205 -----------IPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGS 258
                       :|:.|    ...|||||..|......:  |||.:...:..|.|:     .:.|.
  Fly   142 TDEETEDVDAELPNGT----PVYVAGWGELSDGTASYK--QQKANYNTLSRSLCE-----WEAGY 195

  Fly   259 NYQLPASLMCAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVG-CGQANVPTTFTHVS 322
            .|:   |::|....||..:|....|.|:   :|||.   ...|:.||..| || :..|...|.||
  Fly   196 GYE---SVVCLSRAEGEGICRGDAGAAV---IDDDK---VLRGLTSFNFGPCG-SKYPDVATRVS 250

  Fly   323 KFMEWINPHLE 333
            .::.||..:.:
  Fly   251 YYLTWIEANTQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 65/255 (25%)
Tryp_SPc 95..328 CDD:214473 64/254 (25%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 64/258 (25%)
Tryp_SPc 29..259 CDD:238113 66/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.