DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG9676

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:244 Identity:72/244 - (29%)
Similarity:110/244 - (45%) Gaps:35/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILA---GLSP-NDIMVRAGEWDLSS 153
            |.|.:.:..|||...:|..:||:..|||:|:...|:||||.:.   .::| |::.::||...|||
  Fly    29 VGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSS 93

  Fly   154 SEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTFDRRICTVA 218
            .....|     |..:..|.  ||:|..:|:|:|.|.:.....:||..|:|...|...|..: .::
  Fly    94 GGVRVP-----VATVTVHP--NYNSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATV-DIS 150

  Fly   219 GWGMRSSTDVDIQTIQQKVDLPVVESSKCQR-QLRLTKMGSNYQLPASLMCAGGEEGRDVCSLFG 282
            |||..|... .|......|.:..:....||: .||        |||.:.||....:.:..|  :|
  Fly   151 GWGAISQRG-PISNSLLYVQVKALSRESCQKTYLR--------QLPETTMCLLHPKDKGAC--YG 204

  Fly   283 GFALFCSLDDDPNRYE--QAGIVSFGV-GCGQANVPTTFTHVSKFMEWI 328
            .       ...|..|:  ..|:.||.: |||:| .|..:..|||...||
  Fly   205 D-------SGGPATYQGKLVGLASFVIGGCGRA-APDGYERVSKLRNWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 71/242 (29%)
Tryp_SPc 95..328 CDD:214473 69/240 (29%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 70/242 (29%)
Tryp_SPc 28..248 CDD:238113 72/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457605
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.