DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG33160

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:260 Identity:69/260 - (26%)
Similarity:113/260 - (43%) Gaps:33/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 SYPNALDGSPQVFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRA 146
            ::|:::...|::.|......:.............|.||||:.|..|:||||.:...:.||..:..
  Fly    23 AHPDSVQIQPRIIGGHVSSIKEEKYLVQVTTSEELCGGSLVKPRWVITAAHCVYNKNKNDFKIYG 87

  Fly   147 GEWDLSSSEKLNPPMDRQVIKIMEHEA----FNYSSGANDLALLFLDSPFELRANIQTIRL---P 204
            |     :|.:..|   ..||:.:::.|    ||..:...|:|.|.|:|.. :.|||:||.|   .
  Fly    88 G-----ASNQAGP---YAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDM-IGANIETIPLAAQS 143

  Fly   205 IPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCA 269
            :|    .|.:..|:|||..::...........|.:|:...:.|....|     ..:::..|::||
  Fly   144 VP----ARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFR-----GIHRITRSMVCA 199

  Fly   270 GGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWINPHLEQ 334
            .....:|.|....|..|.       .|.:.|||||||.||..| :|..:|.|.:..:|....:||
  Fly   200 ARLYKKDSCDGDSGGPLV-------YRGQLAGIVSFGYGCASA-LPGIYTSVPEIRDWFQRVVEQ 256

  Fly   335  334
              Fly   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 65/240 (27%)
Tryp_SPc 95..328 CDD:214473 64/239 (27%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 64/241 (27%)
Tryp_SPc 34..253 CDD:238113 65/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.