DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG31827

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:286 Identity:123/286 - (43%)
Similarity:172/286 - (60%) Gaps:12/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VIGMSKSPPQHSVDTL-----LRTSY--PNALDGSPQVFGDQTKPNQFPWVTALFAKGSYLGGGS 120
            |:|:::     :|:.|     |:..|  |:|:.....|...|.||.:|||..|:....|.:||||
  Fly    13 VLGVAE-----NVENLQQIEELKCGYGNPDAVKVQFNVTEGQAKPAEFPWTIAVIHNRSLVGGGS 72

  Fly   121 LITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLAL 185
            ||||.:||||||.:......||:|.||||:..|:.:..|..:..|:|::.|::|||..|||:|||
  Fly    73 LITPDIVLTAAHRIFNKDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLAL 137

  Fly   186 LFLDSPFELRANIQTIRLPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQ 250
            ||||..|.|...|.||.||...::.....|.|||||....:|.....:.:|:|||:|....||.|
  Fly   138 LFLDREFPLTYKINTICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQ 202

  Fly   251 LRLTKMGSNYQLPASLMCAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVP 315
            ||.|::|.||.||..|:|||||:..|.|:..||.||||.:.:||.::||.|||::||||.:.|||
  Fly   203 LRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVP 267

  Fly   316 TTFTHVSKFMEWINPHLEQVLSVPGN 341
            .|:|.|.:|..||...:::.|..|.|
  Fly   268 ATYTDVFEFKPWIVQQIKENLYTPDN 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 110/233 (47%)
Tryp_SPc 95..328 CDD:214473 109/232 (47%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 110/232 (47%)
Tryp_SPc 50..280 CDD:214473 108/229 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471508
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.