DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and CG33127

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:288 Identity:74/288 - (25%)
Similarity:122/288 - (42%) Gaps:51/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GMSKSPPQHSVDTLLRTS-------YPNALDGSPQVFGDQTKPNQFPWVTALF---AKGSYLGGG 119
            |.:|.|  |.....||.:       .|..:||.     |....:..|::.:|.   |..::|.|.
  Fly    15 GAAKLP--HIQHLTLRDTEQVHAEIQPLIIDGY-----DVQGVDNVPYLVSLSLTRATYTHLCGA 72

  Fly   120 SLITPGLVLTAAHILAGL---------SPNDIMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFN 175
            |:|....:|||||.:..|         :|    |.||   :.:...:.....|.|.....|.:||
  Fly    73 SIIGKRWLLTAAHCVDELRTFNGDAVGTP----VYAG---IINRSNVTAAQVRYVDFASTHRSFN 130

  Fly   176 YSSGANDLALLFLDSPFELRANIQTIRLPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVD-- 238
            .::|::::|||.:...||..|.:|.|.||..:..:..:.....|||:   ||.|.....:::.  
  Fly   131 GNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTAAAYGWGL---TDPDGDEYSKELQYA 192

  Fly   239 -LPVVESSKCQRQLRLTKMGSNYQLPASLMCAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGI 302
             .|::.|:.|:..|     .::..|.|..:|:..:    .|...||..|.......|  .|..|:
  Fly   193 FAPLLNSTGCKELL-----PADAPLTAQQVCSQVK----TCYGDGGTPLIYWPITGP--AELVGL 246

  Fly   303 VSFG-VGCGQANVPTTFTHVSKFMEWIN 329
            .|:. :.||.||.||.:|.|..::.||:
  Fly   247 GSWSYMPCGYANRPTVYTSVPPYIGWIH 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 64/249 (26%)
Tryp_SPc 95..328 CDD:214473 63/248 (25%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 67/260 (26%)
Tryp_SPc 41..273 CDD:214473 65/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.