DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and Prss30

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:292 Identity:82/292 - (28%)
Similarity:139/292 - (47%) Gaps:50/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PQHSVDTL-LRTSYP------------------NALDGSPQVFGDQTKPNQFPWVTALF-AKGSY 115
            ||..||.| ||.||.                  ::.|....|.|......|:||..:|: .:..:
Mouse    34 PQWIVDGLTLRRSYAGFFYNGWARGDILPSVCGHSRDAGKIVGGQDALEGQWPWQVSLWITEDGH 98

  Fly   116 LGGGSLITPGLVLTAAHIL-AGLSPNDIMVRAGEWDLSSSEKLNPPMDRQVIK-IMEHEAFNYS- 177
            :.|||||....||||||.. ..|:|:...|:.|...||   .|.|......:: |..|..:.:: 
Mouse    99 ICGGSLIHEVWVLTAAHCFRRSLNPSFYHVKVGGLTLS---LLEPHSTLVAVRNIFVHPTYLWAD 160

  Fly   178 SGANDLALLFLDSPFELRAN------IQTIRLPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQK 236
            :.:.|:||:.||:|  ||.:      :...:.|:...|    :|.|.|||  ::.:.|:.::.|:
Mouse   161 ASSGDIALVQLDTP--LRPSQFTPVCLPAAQTPLTPGT----VCWVTGWG--ATQERDMASVLQE 217

  Fly   237 VDLPVVESSKCQRQLRLTKMGSNYQ----LPASLMCAGGEEG-RDVCSLFGGFALFCSLDDDPNR 296
            :.:|:::|..|::...  ..||:..    :.:.::|||..|| :|.|....|..|.||::   :.
Mouse   218 LAVPLLDSEDCEKMYH--TQGSSLSGERIIQSDMLCAGYVEGQKDSCQGDSGGPLVCSIN---SS 277

  Fly   297 YEQAGIVSFGVGCGQANVPTTFTHVSKFMEWI 328
            :.|.||.|:|:||.:...|..:|.|..:::||
Mouse   278 WTQVGITSWGIGCARPYRPGVYTRVPTYVDWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 71/249 (29%)
Tryp_SPc 95..328 CDD:214473 69/247 (28%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 72/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.