DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and Tpsg1

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:289 Identity:82/289 - (28%)
Similarity:133/289 - (46%) Gaps:44/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LLRTSYPNALDGSPQVF--------GDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHIL 134
            ||..:.|..  |.|||.        |...:...:||..:|..:..::.||||::|..||||||..
  Rat    10 LLLLAVPGC--GQPQVSHAGSRIVGGHAAQAGAWPWQASLRLQKVHVCGGSLLSPEWVLTAAHCF 72

  Fly   135 AG-LSPNDIMVRAGEWDLSSSEKLNPPMD--RQVIKIMEHEAFNYSS------GANDLALLFLDS 190
            :| ::.:|..|..||..::    |:|...  :|:|.        |||      .:.|:||:.|.:
  Rat    73 SGSVNSSDYEVHLGELTIT----LSPHFSTVKQIIM--------YSSAPGPPGSSGDIALVQLAT 125

  Fly   191 PFELRANIQTIRLPIPDKTFDRRI-CTVAGWG-MRSSTDVDIQTIQQKVDLPVVESSKCQRQLRL 253
            |..|.:.:|.:.||.....|...: |.|.||| .:....:......|:..:.||:...|. |...
  Rat   126 PVALSSQVQPVCLPEASADFHPGMQCWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVETCS-QAYS 189

  Fly   254 TKMGSNYQLPASLMCAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTF 318
            :..||..|  :.::||.|.  .|.|....|..|.|.:   ...::|||:||:|.|||:.:.|..:
  Rat   190 SSNGSLIQ--SDMLCAWGP--GDACQDDSGGPLVCRV---AGIWQQAGVVSWGEGCGRPDRPGVY 247

  Fly   319 THVSKFMEWINPHLEQVLSVPGNMLPAMS 347
            ..|:.::.||:.|   :|...|:.:..:|
  Rat   248 ARVTAYVNWIHRH---ILEPGGSGMQGLS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 70/244 (29%)
Tryp_SPc 95..328 CDD:214473 69/243 (28%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 69/247 (28%)
Tryp_SPc 30..260 CDD:238113 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346357
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.