DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and Prss42

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:288 Identity:84/288 - (29%)
Similarity:130/288 - (45%) Gaps:35/288 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GMSKSPPQHS-VDTLLRTSYPNALDGSPQVF------------------GDQTKPNQFPWVTALF 110
            |:|:||.::| ..|.:.|| ..|..||...|                  |...:..::||..:|.
  Rat    39 GLSESPGENSPPPTPVHTS-KVASQGSTTRFPFTNFSIVCGQPLMKIMGGVDAEEGKWPWQVSLR 102

  Fly   111 AKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFN 175
            .:..::.||||:....||||||.:.  |.....|:.|:   .|..:.|..:...:..|..|..|:
  Rat   103 VRHMHVCGGSLLNSQWVLTAAHCIH--SRVQYNVKMGD---RSVYRQNTSLVIPIQNIFVHPKFS 162

  Fly   176 YSSGA-NDLALLFLDSPFELRANIQTIRLPIPDKTFDRRI---CTVAGWGMRSSTDVDIQT-IQQ 235
            .::.. ||:|||.|..|....::|..|  .:|..||..:.   |.|.|||........|.| |.|
  Rat   163 TTTVVQNDIALLKLQQPVNFTSSIHPI--CVPTGTFHVKAGTKCWVTGWGKPDPGAPQIPTEILQ 225

  Fly   236 KVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQA 300
            :||..::...:|...|:.....|...:...::||..|.|:|.|....|..|.|..|   ||:.|.
  Rat   226 EVDQSIILYEECNEMLKKMASTSVDLVKRGMVCAYKEGGKDACQGDSGGPLSCEFD---NRWVQI 287

  Fly   301 GIVSFGVGCGQANVPTTFTHVSKFMEWI 328
            |:||:|:|||:...|..:|.|:.:.:|:
  Rat   288 GVVSWGIGCGRKGHPGVYTDVAFYNKWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 72/239 (30%)
Tryp_SPc 95..328 CDD:214473 71/237 (30%)
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 71/240 (30%)
Tryp_SPc 84..315 CDD:238113 71/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.