DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and Tpsb2

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:260 Identity:81/260 - (31%)
Similarity:128/260 - (49%) Gaps:36/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VFGDQTKPNQFPWVTALFAKGSY---LGGGSLITPGLVLTAAHILAGL---SPNDIMVRAGEWDL 151
            |.|.:...:::||..:|..|.|:   ..|||||.|..||||||.: ||   ||....|:..|..|
  Rat    31 VGGREASESKWPWQVSLRFKFSFWMHFCGGSLIHPQWVLTAAHCV-GLHIKSPELFRVQLREQYL 94

  Fly   152 SSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTF-DRRIC 215
            ..:::| ..::|.|:    |..:.......|:|||.|::|..:..:|....||...:|| ....|
  Rat    95 YYADQL-LTVNRTVV----HPHYYTVEDGADIALLELENPVNVSTHIHPTSLPPASETFPSGTSC 154

  Fly   216 TVAGWGMRSSTDVDIQTIQ--------QKVDLPVVESSKCQRQLRLTKMGSNYQLPA---SLMCA 269
            .|.|||       ||.:.:        ::|.:|:||:|.|.|:.. |.:.:...:|.   .::||
  Rat   155 WVTGWG-------DIDSDEPLLPPYPLKQVKVPIVENSLCDRKYH-TGLYTGDDVPIVQDGMLCA 211

  Fly   270 GGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWINPHLEQ 334
            |.... |.|....|..|.|.:   ...:.|||:||:|.||.:||.|..:|.|:.:::||:.::.|
  Rat   212 GNTRS-DSCQGDSGGPLVCKV---KGTWLQAGVVSWGEGCAEANRPGIYTRVTYYLDWIHRYVPQ 272

  Fly   335  334
              Rat   273  272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 78/251 (31%)
Tryp_SPc 95..328 CDD:214473 77/250 (31%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 80/254 (31%)
Tryp_SPc 30..266 CDD:214473 78/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346376
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.