DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3117 and Prss34

DIOPT Version :9

Sequence 1:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:274 Identity:81/274 - (29%)
Similarity:130/274 - (47%) Gaps:40/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VFGDQTKPNQFPWVTAL------FAKGSYLGGGSLITPGLVLTAAHI--LAGLSPNDIMVRAGEW 149
            |.|.....::|||..:|      .:|..::.|||||.|..||||||.  |..:..:...|:.|:.
  Rat    34 VGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQL 98

  Fly   150 DLSSSEKLNPPMDRQVIKIMEHEAFN---YSSGANDLALLFLDSPFELRANIQTIRLPIPDKTF- 210
            .|..:::|     .:|.||:.|..|:   .:.|..|:|||.|||...|...:..:.||...:.. 
  Rat    99 RLYENDQL-----MKVAKIIRHPKFSEKLSAPGGADIALLKLDSTVVLSERVHPVSLPAASQRIS 158

  Fly   211 DRRICTVAGWG-MRSSTDVDIQTIQQKVDLPVVESSKCQRQL-------RLTKMGSNYQLPASLM 267
            .::...||||| :.....:......::|.:|:|.:|.|:::.       |.||:     :...::
  Rat   159 SKKTWWVAGWGVIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKI-----IKDDML 218

  Fly   268 CAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWINPHL 332
            || |.||||.|....|..|.|..:..   :.|.|:||:|:|||..:.|..:|.|..::.||:.: 
  Rat   219 CA-GMEGRDSCQADSGGPLVCRWNCS---WVQVGVVSWGIGCGLPDFPGVYTRVMSYLSWIHGY- 278

  Fly   333 EQVLSVPGNMLPAM 346
                 ||....|:|
  Rat   279 -----VPKFPEPSM 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 75/253 (30%)
Tryp_SPc 95..328 CDD:214473 74/252 (29%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 76/255 (30%)
Tryp_SPc 33..275 CDD:214473 75/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.